quinta-feira, abril 03, 2008

Pedido aos criacionistas.

No dia 13 de Fevereiro do ano passado, Jónatas Machado escreveu que «Sabemos que as mutações são cumulativas e degenerativas. As mesmas não criam informação genética nova que codifique novas estruturas e funções.» Em resposta a mais de um ano de conversa e vários exemplos em contrário, Jónatas Machado decidiu adoptar o pseudónimo de Perspectiva e afirmar à mesma que «As mutações e a selecção natural diminuem a quantidade e a qualidade da informação genética disponível.»(2)

Peço então aos criacionistas que expliquem como se avalia esta diminuição da quantidade de informação num caso concreto. Abaixo estão cinco sequências de rubredoxinas de bactérias dos géneros Clostridium, Desulfovibrio, Geobacter e Thermoanaerobacter. Segundo a teoria da informação formalizada por Shannon, sendo do mesmo comprimento e usando os mesmos 20 símbolos é preciso a mesma informação para as codificar (225 bits, aproximadamente)*.

MEKYVCTACGYIYDPEKGDPDGGIAPGTAFEDIPDDWVCPICGVGKDMFEKE
MEKWQCTVCGYIYDPEEGDPSQGIEPGTPFEELPDDWVCPDCGVGKDMFEKM
MERWRCTICQYEYDPEAGDPENGIDPGTPFEELPDDWVCPICGAGKDLFEPA
MDIYVCTVCGYVYDPEEGDPDGGIAPGTAFEDIPEDWVCPLCGVGKDLFEKQ
MDIYVCTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAFEKQ

Mas segundo os criacionistas estes descendentes da bactéria perfeita criada por Deus sofreram mutações aleatórias que reduziram a quantidade de informação, umas mais e outras menos. Peço que calculem as diferenças e que expliquem o cálculo.


Também gostava que avaliassem a qualidade da informação com este outro exemplo. Apresento abaixo duas sequências de 24 bits. Uma é uma mensagem codificada por mim e a outra é o resultado de atirar uma moeda ao ar 24 vezes. Novamente, de acordo com a teoria da informação que eu conheço isso não faz diferença nenhuma. 24 bits são 24 bits. Mas se há diferenças na qualidade da informação gostava que explicassem como é que medem essa qualidade para distinguir a sequência criada com inteligência e da outra criada por processos físicos sem inteligência.


000110100011100100110100
010110110111111000111110

Finalmente, se uma mutação altera um nucleótido num gene e reduz a informação genética, pedia que explicassem porque é que a mutação inversa não aumenta a informação genética, visto que restaura a sequência original.


Não exijo que respondam a tudo. Se não souberem, aceito que não saibam. Mas nesse caso admitam que isso das mutações só reduzirem informação e da informação ter mais ou menos qualidade é treta.



*Em média. Podemos codificar algumas sequências com menos bits e outras com mais, mas se tivermos que enviar qualquer sequência com este comprimento, em média precisamos de 225 bits para cada uma e qualquer diferença será só devido à codificação e não à sequência só por si.

1- 13-2-07, Charles e o seu ismo
2- 2-4-08, O neo-nãoseiquê.

52 comentários:

  1. "Finalmente, se uma mutação altera um nucleótido num gene e reduz a informação genética, pedia que explicassem porque é que a mutação inversa não aumenta a informação genética, visto que restaura a sequência original."

    Este raciocínio está genial and yet so simple.

    Já agora, se as mutações não geram nova informação, como explicar os organismos multiresistentes, como a tuberculose?

    ResponderEliminar
  2. «Já agora, se as mutações não geram nova informação, como explicar os organismos multiresistentes, como a tuberculose?»

    Foi o pecado original: Adão comeu a maçã, e basicamente o mundo começou a degenerar. Assim surgiram uma série de mutações que tiram informação aos virus e bactérias de forma que estas deixam de se saber comportar, e passam a atacar humanos (e outros animais), e nem se lembram como é que se morria com os antibióticos. Quanto mais informação perdem, mais resistentes ficam.

    ResponderEliminar
  3. A questão que o Ludwig Krippal coloca é interessante, tanto mais que finalmente ele admite que o DNA contem informação.

    De onde é que veio toda essa informação?

    Quem a armazenou no núcleo das células, sendo que os animais para existirem necessitam de informação que existe nas dentro das células que existem dentro de si?

    Como surgiu o DNA, se ele necessita de enzimas, estas de RNA e este de DNA?

    É bom ver o Ludwig a reconhecer as quantidades inabarcáveis de informação que existem no DNA, codificadoras de estruturas e funções extremamente complexas.

    Agora, se o Ludwig nos explicar que informação é que uma sequência aleatória de números pode ter, muito gostaríamos de saber.

    Contrariamente ao que suponha Claude Shannon, a informação não é apenas uma quantidade estatística.

    Ela é também uma qualidade semântica.

    A informação, para existir, supõe um código.

    Um código é um convenção de símbolos que representam algo (ideias, conceitos, relações, de natureza mental, física, química ou biológica).

    Uma convenção de símbolos supõe sempre uma inteligência que confere significado aos símbolos.

    A informação é transmitida por símbolos dotados de um significado, porque integrados numa determinada linguagem.

    A informação supõe sempre uma origem inteligente.

    A sequência de letras “NO CASO DE UM NAUFRÁGIO AQUI ESTÁ O SALVA VIDAS” tem muito mais informação do que a sequência “ADIOJUÇISUPUPIUAHPIUPAS”, independentemente dos bits que Shannon consiga estatisticamente encontrar nesta última sequência. Esta sequência não representa nada.

    Ela não pode ser descodificada, transcrita, traduzida e executada para a transmissão de um conceito, a realização de uma operação ou o fabrico de um maquinismo.

    Do mesmo modo, uma sequência aleatória de números do tipo 01101010001000111010 não representa nada, se não existir qualquer convenção que lhes atribuía um significado.

    A mesma também não pode ser traduzida e executada.

    Diferentemente, o código genético é utilizado para representar realidades (v.g. aminoácidos) que serão fabricadas depois da transcrição, tradução e execução do código.

    Nada disso ocorre numa sequência aleatória.

    Além disso, no exemplo que demos sobre o SALVA VIDAS, trata-se de informação vital.

    O problema de Claude Shannon é que ele não atentou para a qualidade, a importância e a funcionalidade da informação.

    Ele apenas se preocupou com a estatística da informação, tendo descurado a sua sintaxe (nucleótidos), a sua semântica (aminoácidos) e a sua pragmática (proteínas e organismos vivos).

    Nos sistemas biológicos, como em tudo na vida, a importância da informação pode variar.

    Alguma informação é vital, outra é meramente trivial.

    Nos sistemas biológicos a perda ou destruição de uma informação pode ser letal, enquanto que a perda ou destruição de outra informação pode significar que uma pessoa tem olhos azuis em vez de olhos castanhos, sem que isso lhe traga quaisque problemas de saúde.

    A teoria de Shannon é bastante incompleta, não entrando em conta com questões essenciais da informação.

    Para Claude Shannon, a sequência FSÇ IJÇ PSH JUÇ OZX, em tanta informação como NÃO TEM PAI NEM MÃE. Ora, isso é inteiramente falso.

    Shannon apenas mede estatisticamente a frequência da ocorrência de letras ou números.

    Mas a informação vai muito mais além disso.

    Além da dimensão estatística, a informação tem uma sintaxe e uma semântica.

    Além disso, ela têm uma dimensão pragmática, na medida em que através da execução da informação se pretende atingir um dado resultado (v.g. construir um avião, transmitir uma ideia, tocar uma música, fabricar aminoácidos, proteínas e organismos).

    As sequências de simbolos (v.g. letras, números, notas musicais, nucleótidos) têm uma função representativa.

    Ora, nada disso acontece uma sequência aleatória de letras ou números.

    As proteínas não são sequências arbitrárias de aminoácidos. Estes não são sequências arbitrárias de nucleótidos.

    Esta crítica dirigida a Claude Shannon não é exclusiva dos criacionistas.

    A mesma tem sido apontada por muitos cientistas teóricos da informação não criacionistas.


    Para além da existência de um código do DNA, alguns cientistas, no domínio da teoria das cordas, têm afastado a ideia de pequenas partículas de dimensão zero a favor de pequenas cordas de energia unidimensionais e super simétricas, cada uma tendo as suas ressonâncias vibratórias, como a corda de uma guitarra, caracterizada pela força fundamental em questão.

    De acordo com este entendimento, as partículas específicas correspondem a diferentes modos de oscilação (ou estados quânticos) da corda.

    É igualmente interessante que alguns físicos acreditam que estas cordas de energia, ou são fechadas, formando um círculo, ou são abertas, formando intervalos numa linha.

    Se assim é, então é quase impossível não ver aí a presença de computações matemáticas multidimensionais para formar estruturas materiais complexas a partir de um código binário.

    Muito há ainda a estudar.

    A verdade é que parece que nos aproximamos da conclusão de que não apenas a vida, mas também a própria matéria, são especificados por um código informativo.

    Se assim for, como sabemos que é no caso da vida, está inteiramente corroborada a ideia de que Deus criou o Universo e a Vida pela sua Palavra, tal como a Bíblia ensina.

    Veja-se,

    Becker, K., M. Becker, J. H. Schwarz. 2007. String theory and M-theory: A modern introduction. Cambridge, New York: Cambridge University Press.

    ResponderEliminar
  4. Muitos evolucionistas afirmam que o código de DNA é universal e que isso é uma prova de um ancestral comum.

    Mas isto é falso.

    Existem excepções, algumas conhecidas desde os anos de 1970.

    Um exemplo é o Paramecium, onde alguns dos 64 (43 or 4x4x4) codões possíveis codificam diferentes aminoácidos.


    Mais exemplos têm sido encontrados várias vezes.

    Do mesmo modo, alguns organismos têm um código para outros aminoácidos para além dos 20 tipos básicos.


    Mas se uns organismos evoluiram para dar origem a outros, com códigos diferentes, todas as mensagem codificadas seriam destruídas, como sucederia às mensagens escritas se as teclas do computador fossem alteradas.

    Este é um grande problema para a evolução de um código para outro.


    Além disso, as células têm “centrais energéticas”, as mitocôndrias, com os seus próprios genes.

    Ora, sucede que as mesmas têm um código genético ligeiramente diferente.

    Certamente que muito do código de DNA é universal, mas isso é o resultado inteiramente consistente com um Criador comum.

    De todos os milhões de códigos genéticos possíveis, os nossos, ou algo quase igual a ele, são óptimos do ponto de vista do armazenamento de informação de da detecção e correcção de erros.

    As excepções que existem têm o mérito de frustrar todas as tentativas de explicar a origem dos organismos com base na evolução a partir de um ancestral comum.

    ResponderEliminar
  5. Depois de todo este debate, continuamos sem saber a explicação evolucionista para o modo como o DNA surge, sendo que o RNA depende do DNA, as enzimas dependem do RNA e o DNA depende das enzimas.

    Além disso, também necessitamos de saber como é que a vida surge, já que mesmo um cadáver tem DNA.


    Ou seja, o circuito informacional da vida encontra-se fechado e ainda ninguém mostrou como é que ele poderia ser aberto sem o concurso de uma inteligência.

    As mutações aleatórias destroem informação e as mutações não aleatórias recombinam informação pré-existente.

    Também a mera duplicação de informação pré-existente não cria informação nova.

    Por seu lado, a selecção natural vai gradualmente eliminando a informação genética.

    Ela explica porque é que uns indivíduos e espécies sobrevivem e outros não, mas não explica como é que uns e outros originam.

    Não existe qualquer evidência da origem de espécies mais complexas a partir de espécies menos complexas. Pelo menos, não no mundo real.

    Do mesmo modo, ficamos sem saber como é que se passa de bactérias para bacteriologistas e onde é que podemos encontrar vestígios fósseis desta evolução.

    O registo fóssil mostra sempre espécies totalmente formadas e funcionais e facilmente enquadráveis nas taxonomias existentes.

    Não existe qualquer apoio fóssil para as hipotéticas árvores filogenéticas.

    Do mesmo modo, as mesmas são constantamente revistas e restruturadas com base em sucessivas descobertas recentes da genética.

    Mesmo os trilobitas, encontrados nas rochas cambrianas, são já plenamente formados e altamente sofisticados, sem antecedentes evolutivos.


    Aquilo que realmente sabemos é que o DNA é muito mais complicado do que a simples codificação de proteínas, facto que todos os dias é confirmado pelas descobertas mais recentes.

    Nenhum criacionista contesta esssa descobertas, sendo que as mesmas são totalmente consistentes com a crença no Criador.

    Por exemplo, pelo facto de as letras de DNA serem lidas em grupos de três, pode fazer toda a diferença o momento a partir do qual a leitura começa a ser feita.

    Assim, a sequência GTTCAACGCTGAA pode ser lida a partir da primeira letra GTT CAA CGC TGA A, mas uma proteína totalmente diferente irá resultar de uma leitura iniciada na segunda letra TTC AAC GCT GAA.

    Tudo indica, portanto, que o DNA é um sistema de armazenamento de informação muito mais complexo, compacto e eficiente do que se pensava até há pouco.

    Por aqui se vê, também, o potencial de criação de ruído que as mutações pontuais podem ter neste sistema extremamente complexo.

    Isto explica, em parte, a descoberta surpreendente, do Projecto do Genoma Humano, de que no ser humano existem “apenas” 35 000 genes, embora os seres humanos consigam produzir mais de 100 000 proteínas.

    Para os criacionistas, a existência de informação codificada (elemento imaterial) eficientemente armazenada na molécula do DNA (elemento material) é inteiramente consistente com a noção de que um Deus omnipotente e omnisciente, espiritual, é o Criador do mundo material e da vida.

    A ciência corrobora inteiramente a Criação. O problema dos criacionistas não é com a ciência, mas apenas com afirmações como “a vida surgiu por acaso há biliões de anos”, “todos os seres vivos descendem de um ancestral comum”, “as espécies menos complexas dão origem a espécies mais complexas”, etc.

    Essas afirmações não são científicas, na medida em que se apresentam totalmente destituídas de confirmação empírica e impossíveis de serem provadas, cuja validade só se aplica ao País das Maravilhas da Alice.

    No mundo real, verifica-se invariavelmente que a vida só vem da vida e os seres vivos reproduzem-se de acordo com a sua espécie, tal como a Bíblia afirma.

    A Bíblia é um livro do mundo real. A teoria da evolução é pura fantasia naturalista.

    ResponderEliminar
  6. "O registo fóssil mostra sempre espécies totalmente formadas e funcionais e facilmente enquadráveis nas taxonomias existentes."

    Como assim? Esperava encontrar o quê? Meias espécies? Tem a certeza que compreendeu o que a teoria da evolução diz? Mostra sempre espécies formadas? Esta agora, sério que não entendi...


    Ludwig,
    a pedir calculos aos criacionistas?
    eheheh Cálculos? A parte dedicada à matemática não vem na Biblia!

    2+2 ainda vá lá agora um diferencial ou um simples limite e tal isso já é abusar! Usa demasiado a razão para poder ser usada sem acelerar a degeneração do DNA que o geitoso do Adão começou... malandro!

    ResponderEliminar
  7. Este comentário foi removido pelo autor.

    ResponderEliminar
  8. Ludwig:

    O Perspectiva apresentou um argumento fortíssimo para mostrar que a quantidade de informação não corresponde ao número de bits: foram três comentários gigantes, cada um com cerca de 5000 caracteres, e as perguntas que tu fizeste continuaram por responder.

    Querias melhor argumento que este?

    ResponderEliminar
  9. Caro Jónatas,

    «A questão que o Ludwig Krippal coloca é interessante, tanto mais que finalmente ele admite que o DNA contem informação.»

    "Finalmente"?

    Que tal em setembro de 2006:

    «Pela definição de Ralph Hartley, a quantidade de informação numa sequência é tanto maior quanto mais símbolos diferentes possa ter e quanto mais longa for a sequência. Por isso o DNA tem mais informação quanto mais nucleótidos tiver»

    Ou em Dezembro, «O número exacto de pelos no nariz, a cor dos olhos, a velocidade de crescimento das unhas dos pés, tudo isso pode variar sem afectar minimamente a sobrevivência ou a informação contida no genoma.»

    E assim por diante. Siga a tag criacionismo e vai ver que referi muitas vezes a informação no DNA e no genoma. Parece-me desonesto da sua parte insinuar que agora estou a admitir alguma coisa de novo.

    «Agora, se o Ludwig nos explicar que informação é que uma sequência aleatória de números pode ter, muito gostaríamos de saber.»

    Experimente transmitir 100 Mb de números aleatórios. Sabe quanta largura de banda precisa? 100 Mb. Sabe quanta informação transmitiu? 100 Mb.

    Um quilo de pedras partidas ao acaso pesa o mesmo que um quilo de diamantes polidos com precisão. A informação é uma quantidade análoga. 100 Mb são 100 Mb, seja como foram criados. E um bom exemplo disso é que o Jónatas não foi capaz de distinguir entre a sequência aleatória que eu apresentei e a outra que não era aleatória.

    Falta-lhe agora admitir que a teoria da informação não é uma àrea que domina e não é relevante para o seu criacionismo. Fico à espera.

    ResponderEliminar
  10. Será que "ImFalleeinesSchiffesWrack hieristdasLebenBoje" tem a mesma informação que "No caso de naufrágio aqui está o salva vidas"?

    É que sinceramente a mim parecem um conjunto de caracteres aleatórios

    ResponderEliminar
  11. O Ludwig baseia a sua noção de informação no trabalho de Claude Shannon, aquela que diz ser a única teoria da informação que conhece.

    Realmente Claude Shannon, na sua obra A Mathematical Theory of Communication, (1948), teve o mérito de avançar com uma definição matemática de informação e de propor uma medida de informação (bit= binary digit), com a vantagem de permitir o estudo das propriedades quantitativas da informação.

    A sua obra é especialmente relevante quando se trata de resolver problemas relacionados com a transmissão e o armazenamento de informação.

    No entanto, ela nada nos diz sobre a qualidade dessa informação.

    Com efeito, do ponto de vista da teoria de Shannon dizer E= mc^2 tem tantos bits de informação como a sequência A=ot^8, quando a verdade é que foi necessário um estudioso como Albert Einstein para chegar à informação necessária para se poder formular a primeira equação, ao passo que a segunda não significa nada.


    Claude Shannon não consegue medir quanto conhecimento é necessário para obter determinada informação.

    Para ele é irrelevante se se está diante de informação extremamente importante, tendo por trás muito conhecimento, ou se se está perante uma sequência aleatória de números (sendo que é necessário alguém inteligente para identificar um número como tal).

    Há pessoas, como o Ludwig, que usam muitas palavras para transmitir pouca informação.

    Há outras, como Einstein, que são capazes de usar alguns símbolos para transmitir muita informação.

    A definição de informação de Claude Shannon ocupa-se exclusivamente das propriedades estatísticas da informação.

    O significado da mesma, a sua importância e o grau de conhecimento que ela tem por detrás são factores totalmente ignorados.

    A verdade é esta: o conhecimento acumulado de todos cientistas do mundo não é suficiente para perceber como é que o DNA e a vida poderiam ter surgido por acaso nem para compreender o funcionamento de todos os sistemas codificados em DNA (v.g. cérebro humano)

    Isso significa que o conhecimento que está por detrás da informação contida do DNA é maior do que o conhecimento de todos os cientistas juntos.

    Do mesmo modo, o DNA é o sistema mais eficaz de armazenamento de informação que se conhece.

    Ora, tudo isto é inteiramente consistente com a crença num Criador omnipotente e omnisciente.

    ResponderEliminar
  12. Fulano de tal pergunta:


    Será que "Im Fall eeines Schiffes Wrack hier ist das Leben Boje" tem a mesma informação que "No caso de naufrágio aqui está o salva vidas"?

    Claro que tem! O que mostra que a informação é uma grandeza imaterial que não se confunde com o código (alemão ou português) em que é transmitida.

    A informação é imaterial, que não tem massa nem peso. Um processo puramente material não pode criar informação.

    A informação é a base de todos os sistemas físicos e biológicos dirigidos por um programa.


    Uma coisa é a informação (uma grandeza mental imaterial) outra coisa é o código em que é vertida (também imaterial) outra coisa ainda é saber se a mesma é armazenada em banda magnética, papel, papiro (elemento material).

    Não existe informação sem código, nem código sem inteligência. Não existe informação sem inteligência.

    Na sua origem, os fluxos de informação têm sempre uma inteligência.

    O DNA tem um elmento imaterial (informação; código) e um elemento material (nucleótidos). O erro dos evolucionistas é não perceberem que a informação, enquanto elemento inteligente e imaterial, só pode ter uma origem inteligente e espiritual.

    A língua alemã, apesar de ser uma criação inteligente, não cria, em si mesma, informação.

    São as pessoas que criam informação e usam a língua alemã, ou outra, para transmitir e armazenar informação.

    Do mesmo modo, o DNA não cria a sua própria informação.

    Ele necessita de enzimas para a sua síntese, que necessitam de RNA, que por sua vez pressupõe a existência de DNA, que por sua vez não existe sem enzimas, etc., etc.

    Foi necessário Deus para criar a informação e criar o DNA como sistema eficaz de armazenamento de informação e como um circuito informacional fechado.

    Sobre isso, a teoria de Shannon não tem nada a dizer, a não ser que o corpo humano processa, por dia, cerca de 3 x 10^24 bits de informação.

    ResponderEliminar
  13. Caro Jónatas:

    aqui nesta frase
    Há pessoas, como o Ludwig, que usam muitas palavras para transmitir pouca informação.
    enganou-se numa palavra; onde se encontra «Ludwig», devia substituir por «Jónatas».

    Quanto às suas mal-amanhadas explicações para a falta de universalidade do código genético, mais facilmente me convencia que haveria um Criador supremo se realmente não houvesse excepções ao código! Pense nisto, vá, como evolução, neste caso mutações aleatórias que, ao não trazerem visiveis prejuizos à viabilidade destes organismos, foram mantidas ao longo das gerações... E já se deu conta que o código genético dos mitocôndrios é em tudo semelhante ao dos organismos celulares mais primitivos? Já ouviu falar da teoria da endosimbiose?

    Rui Almeida.

    ResponderEliminar
  14. Caro Jónatas,

    «No entanto, ela nada nos diz sobre a qualidade dessa informação.»

    Pois foi por isso mesmo que eu lhe pedi para explicar como se mede essa tal qualidade da informação.

    Diga lá então qual das duas sequências de 0s e 1s codifica a minha mensagem e qual é apenas ruído aleatório de má qualidade.

    Ou então admita que isso da qualidade da informação não faz sentido....

    ResponderEliminar
  15. perspectiva,

    «Claro que tem! O que mostra que a informação é uma grandeza imaterial que não se confunde com o código (alemão ou português) em que é transmitida.»

    Só tenho um comentário a fazer.

    QmVtIHNlIHbqIHF1ZSBvIHBlcnNwZWN0aXZhIG7jbyBzYWJlIG5hZGEgc29icmUgVGVvcmlhIGRhIEluZm9ybWHn428u

    Ludwig,

    UGFyYWLpbnMgcGVsYSBwYWNp6m5jaWEgYSBhdHVyYXIgY3JpYWNpb25pc3RhcyEgQ3JpYWNpb25pc21vIOkgdHJldGEu

    ResponderEliminar
  16. Ludwig pergunta:

    "Diga lá então qual das duas sequências de 0s e 1s codifica a minha mensagem e qual é apenas ruído aleatório de má qualidade."

    Pergunto.

    O Ludwig mede a informação contida nos testes dos seus alunos apenas com base em bits?

    Ou considera a qualidade dessa informação?

    Os seus alunos gostariam de saber!

    Se por acaso considera essa qualidade, então admite que nos mesmos bits podemos ter informação com maior ou menor qualidade!

    Já agora, quais são os seus critérios de avaliação da qualidade de informação?

    De um professor de pensamento crítico espera-se que consiga avaliar a qualidade da informação e não apenas ter uma concepção estatística e unidimensional da mesma.

    Mas vejamos a sua pergunta.

    Para responder à pergunta formulada pelo Ludwig qualquer pessoa necessitaria de conhecer previamente o código que o Ludwig inteligentemente criou ou utilizou.

    A verdade é que uma mensagem supõe sempre uma origem inteligente.

    A informação necessita sempre de um código e um código supõe sempre uma inteligência.

    Não há código sem inteligência, porque a escolha de uma convenção de símbolos (v.g. letras, algarismos, notas musicais, nucleótidos) supõe sempre uma opção inteligente.

    A informação pode ser medida em bits, mas nem tudo o que se mede em bits pode ser considerado como informação.

    Uma sequência aleatória de símbolos é vazia de informação.

    Paradoxalmente, para Claude Shannon uma sequência aleatória de letras pode ter mais informação (estatisticamente falando) do que a fórmula de Einstein segundo a qual E= mc^2.

    Tanto basta para mostrar as limitações do trabalho de Shannon.

    Duas sequências de letras ou algarismos podem ter ou não ter informação.

    Tudo depende da prévia existência de um código, determinado por uma inteligência.

    O acesso a essa informação depende, igualmente, do conhecimento prévio desse código e da capacidade para reconhecer nele um significado.

    Algumas nuvens de fumo podem parecer aleatórias para uns e conter uma mensagem para outros.

    O facto de uma pessoa não conseguir ler os sinais de fumo não significa que os mesmos não tenham informação nem retira à informação qualquer das suas propriedades imateriais.

    Um computador, uma máquina de multibanco, uma máquina de lavar carros ou uma linha de montagem podem ter sido programados para reconhecer um código com instruções executáveis para a realização de uma determinada operação (v.g. movimentação das escovas) para atingir um determinado resultado (v.g. lavagem de um carro).

    A sequência “Im Amfang war die Information” pode parecer uma sequência aleatória de letras para quem não saiba alemão.

    É a existência e o conhecimento de um código que permite dar um significado a sequências de símbolos.

    Até à descoberta da Pedra de Roseta, os hieróglifos não passavam de alguns desenhos nas paredes das pirâmides e dos palácios egípcios.

    A compreensão do significado pode permitir a uma pessoa (ou a um maquinismo programado para reconhecer essa informação), realizar várias finalidades (v.g. transmitir uma ideia, levantar dinheiro numa caixa de multibanco; activar uma linha de montagem; construir aminoácidos, proteínas e máquinas moleculares).

    Uma sequência aleatória de letras em princípio não representa nada. Só poderá representar se conseguir ser reconhecida por uma linguagem pré-existente (como no caso de um macaco que, por acaso, consiga dactilografar "penso, logo existo").

    O método de Shannon não distingue entre sequências de letras aleatórias e sequências de letras com significado informativo.

    Como disse, para Shannon o palavreado de um ignorante tem mais bits (e por isso mais informação) do que a fórmula concisa e rigorosa de um especialista.

    Daí que mesmo uma quantidade relativamente pequena de informação genética possa fazer toda a diferença, do ponto de vista qualitativo, como no caso das diferenças genéticas (6%-8%) entre chimpanzés e seres humanos.

    Aquilo que Claude Shannon nos permite concluir é apenas que é necessário mais espaço para armazenar e transmitir o palavreado de um ignorante do que para armazenar e transmitir a fórmula de um especialista.

    Shannon ocupou-se apenas da estatística da informação.

    Mas a informação não é só estatística. Também é sintaxe (linguagem), semântica (significado) e pragmática (acção) e apobética (resultado).

    O DNA tem todas essas dimensões, numa quantidade e qualidade que transcende toda a informação criada pelo homem.

    Além de permitir construir máquinas moleculares de complexidade inabarcável (qualidade da informação), o DNA tem a mais elevada densidade informativa (quantidade de informação).

    No alfabeto genético, as moléculas de DNA contém apenas as quarto bases de nucleótidos ATGC. O conteúdo de informação de cada letra é de 2 bits/nucleótido. A densidade estatística da informação do DNA é de 1.88 x 10^21 bits/cm^3.

    Para os criacionistas, a fórmula concisa e rigorosa de um especialista tem mais quantidade e qualidade de informação do que o palavreado de um ignorante, por mais bits que ele possa representar.

    Como disse, o trabalho de Shannon só tem realmente utilidade para resolver problemas de transmissão e armazenamento de informação.

    Ele não serve para mais nada.

    O DNA contém informação codificada, passível de ser transcrita, traduzida, descodificada e executada, permitindo a realização de operações extremamente complexas e precisas.

    Não estamos, por isso, diante de sequências aleatórias de nucleótidos ou de aminoácidos.

    Estamos perante informação com grande qualidade e especificidade, que denota muito mais conhecimento do que todo o conhecimento da comunidade científica do século XXI, que beneficia do conhecimento acumulado pelas gerações anteriores.

    Ora, isso é inteiramente consistente com a ideia de que, quem criou a vida, tem mais conhecimento, informação e poder do que toda a comunidade científica junta. Esse alguém é Deus.

    ResponderEliminar
  17. Rui Almeida pergunta:

    "Já ouviu falar na teoria da endosimbiose?"

    Algo deve estar estar muito mal com a teoria da evolução quando para explicar a origem de um organismo necessitamos de outros organismos pré-existentes.

    Trata-se aí de recombinação de informação genética nova, e não de criação de estrutura e funções novas e mais complexas.

    ResponderEliminar
  18. Caro Jónatas,

    não se trata da origem de um novo organismo, mas de um organelo. Completamente diferente. Suponha que há muitos milhões de anos tínhamos duas populações de organismos diferentes, sendo uma evolutivamente mais avançada que a população vizinha. Imagine agora que, por um processo endocitótico, o organismo maior e mais avançado assimilava o outro. Não precisava de ter um designio inteligente, bastava ser uma obra do acaso, da mesma maneira que um cão engole uma pedra ou uma baleia engole pedaços de navios afundados. Imagine que, estatisticamente, uma em um milhão dessas assimilações revelava-se frutuosa para os dois organismos, i.e., o primeiro podia beneficiar do fluxo de electrões gerados pelo organismo assimilado (é só um exemplo, pode ser este ou outro qualquer processo) enquanto o segundo beneficiava de fácil acesso a energia e nutrientes. O organismo assimilado conseguiria reproduzir-se autonomamente dentro do seu hospedeiro e o hospedeiro, ao reproduzir-se, incluiria nas células originadas cópias do organismo assimilado.

    Agora imagine que ao longo do processo evolutivo, quer o hospedeiro quer o hóspede iriam sofrendo mutações. O hospedeiro, sempre que adquirisse uma mutação que lhe fosse vantajosa (i.e. facilitasse a sobrevivencia), mantê-la-ia. O hóspede, dado o ambiente controlado em que se encontra, não se importaria muito se por acaso sofresse uma mutação que lhe retirasse características agora desnecessárias (como por exemplo cilios para se movimentar).

    Já lhe faz mais sentido?
    Rui Almeida.

    ResponderEliminar
  19. - com - dá +04/04/08, 13:33

    "Como disse, para Shannon o palavreado de um ignorante tem mais bits (e por isso mais informação) do que a fórmula concisa e rigorosa de um especialista.
    ...............................................................................................
    Aquilo que Claude Shannon nos permite concluir é apenas que é necessário mais espaço para armazenar e transmitir o palavreado de um ignorante do que para armazenar e transmitir a fórmula de um especialista."

    Será então por isso que o comentário das 10:43 do Jónatas precisou de 5879 caracteres? mais do dobro que os 2708 caracteres usados no post original do Ludwig!
    De qualquer modo não é um recorde pois Perspectiva já nos presenteou com textos bem mais longos.

    Mas óbviamente que o Jónatas ou o seu alter ego - DEUS só produz informação altamente qualificada concisa e compactada ao máximo pelo que devemos vergar-nos perante aquela exposição de infinita sabedoria.

    Não Perspectiva, não é nada disso! Que grande confusão vai nessa cabeça.
    Shannon não disse nada disso e de facto a semântica não é uma propriedade intrínseca da informação, se ela não existir no lado do receptor só produz disparate. Penso que foi o que aconteceu com o Jónatas Perspectiva Deus.

    O que Shannon disse é que a informação contida na mensagem é igual à entropia da sua representação binária ou seja é o somatório de -p(xi)log(p(xi)), onde p(xi) é a probabilidade de ocorrência de cada sequência de bits xi .
    Ou seja quantidade de bits e quantidade de informação são coisas diferentes. Como corolário a entropia da mensagem (ou da sequência de bits na sua representação binária) representa o comprimento mínimo que a mensagem pode ter.
    Portanto como ADN humano está muito mais compactado que o ADN da cebola, tem muito mais entropia ou o que é o mesmo, muito mais informação! Capiche ? Acho que não !
    Chegamos aqui a uma conclusão muito interessante que é: mais entropia representa a mesma coisa que mais informação!

    Perspectiva, o tema não é para curiosos! É demasiado complexo para que se possa vir para aqui mandar umas larachas e querer tirar uma conclusões tendo apenas um conhecimento superficial do assunto. São precisos anos de estudo. De facto a bíblia é muito mais fácil :)

    ResponderEliminar
  20. Caro Jónatas,

    «O Ludwig mede a informação contida nos testes dos seus alunos apenas com base em bits?

    Ou considera a qualidade dessa informação?»


    Nem uma nem outra. Não avalio os teste pelo número de bits e, se o Jónatas quer usar o termo "informação" no sentido técnico, também não faz sentido falar de qualidade. Trinta bits são trinta bits, não há bits melhores que outros.

    Mesmo usando o termo num sentido subjectivo e vago não é pela "qualidade" da resposta que eu avalio os alunos. Se eu peço que implementem um algoritmo e me respondem com um soneto lírico, por muita qualidade que o soneto tiver levam zero nessa pergunta.

    E essa é a grande confusão que o Jónatas faz. Quando eu avalio as respostas do exame estou a avaliar a capacidade de responder de uma certa forma a uma pergunta. Não é nem a quantidade da informação que conta nem essa tal "qualidade" que é subjectiva. É a adequação ao propósito do exame.

    Mas a teoria da informação não mede a adequação da mensagem a um propósito. Mede as propriedades da mensagem em si. Se pode ser comprimida, descrita por um algoritmo mais símples, de quantas possibilidades foi seleccionada, etc.

    É por isso que o Jónatas confunde a informação que se pode medir em algo com o ADN com a adequação a um propósito inteligente. Não são o mesmo. Como certamente descobrirá qualquer aluno que responda aos seus exames em coreano ou swahili.

    ResponderEliminar
  21. Jónatas,

    «Algo deve estar estar muito mal com a teoria da evolução quando para explicar a origem de um organismo necessitamos de outros organismos pré-existentes.»

    Mas se precisarmos de deuses já não há problema?

    ResponderEliminar
  22. Jónatas,

    «O DNA contém informação codificada, passível de ser transcrita, traduzida, descodificada e executada, permitindo a realização de operações extremamente complexas e precisas.»

    Repito então o meu pedido. Uma das sequências de 0s e 1s que eu dei no post foi criada traduzindo e codificando por operações complexas e precisas da minha mente. A outra foi atirando uma moeda ao ar.

    Como é que o Jónatas as distingue? E, se não distingue, porque é que assume que o ADN teve que ser criado com inteligência?

    ResponderEliminar
  23. - com - dá +04/04/08, 15:23

    A semântica não é uma propriedade intrínseca da informação, ela tem que estar presente no destinatário da mensagem.

    Ora aqui está o que penso ser uma verdade profunda e de implicações vastas a todos os níveis: na cosmologia, na física (quântica), na química, na biologia, nas TI, na neurologia, psicologia .... Tenho pena que o Ludwig nunca tenha trazido este tema à baila.

    Vou tentar clarificar com um exemplo mais sensível: A epistemologia genética afirma que os indivíduos iniciam a sua aprendizagem após o nascimento (ou mesmo até ainda durante a vida intra-uterina). Como é que isso é possível? Como é que o indivíduo pode descodificar a informação se ainda não possui a semântica necessária? Parece-me um problema em tudo semelhante ao da primeira célula !
    Mais ainda, admitindo que em dado momento surge a tal "primeira célula semântica", como é que as sinapses são estabelecidas de forma a que, perante uma diversidade quase aleatória de estímulos possíveis, a esmagadora maioria dos seres humanos desenvolve competências iguais (não em grau mas em género) como são a linguagem, a abstração, a noção de número,... ? Parece-me um problema em tudo semelhante ao da selecção natural !

    ResponderEliminar
  24. - com - dá +04/04/08, 15:33

    Só espero que o Perspectiva nos saiba explicar o funcionamento da glandula pineal! ;)

    ResponderEliminar
  25. Ludwig pergunta:

    "Mas se precisarmos de deuses já não há problema?"

    Para quem acredita no Deus da Bíblia não há problema nenhum.

    ResponderEliminar
  26. Naquele Deus que se passa muito e parte a loiça toda, mata criancinhas e inunda a Terra toda de cada vez que lhe apetece?

    UUUUUHHHHHHH!!!
    Tenha medo... muito medo...

    (lá se vai mais um pedaço de DNA)

    ResponderEliminar
  27. O problema é que o Deus da Biblia parece que criou a Terra em 6 dias e depois meteu baixa por 6000 (alegados) anos!! Deus trabalhava na Administração Pública Portuguesa?

    ResponderEliminar
  28. Ludwig diz:

    “Mas a teoria da informação não mede a adequação da mensagem a um propósito. Mede as propriedades da mensagem em si. Se pode ser comprimida, descrita por um algoritmo mais símples, de quantas possibilidades foi seleccionada, etc.”

    O Ludwig reconhece que a informação que os seus alunos lhe fornecem pode ser melhor ou pior, mais ou menos importante.

    Já não é mau.

    Pelo menos isso permitir-lhe à perceber melhor porque é que a esmagadora maioria das mutações genéticas é deletéria, afectando as funções celulares e a robustez (fitness) dos seres vivos e podendo conduzir às mais diversas doenças e nalguns casos à morte.

    O Ludwig confunde a teoria da informação, com a teoria estatística da informação de Claude Shannon.

    Esse conceito meramente estatístico conduz ao resultado paradoxal de considerar que uma sequência aleatória de letras, por ser mais improvável, tem mais informação do que a fórmula E= mc^2.

    Muitos cientistas não evolucionistas têm apontado a insuficiência da teoria de Shannon.


    É evidente que a teoria estatística de Claude Shannon é unidimensional e imprópria para compreender a informação, que é um conceito complexo, dotada de dimensões estatística (frequência de símbolos), sintáctica (linguagem), semântica (significado) pragmática (executabilidade) e apobética (realização de um resultado).

    Como tenho dito, a informação contida no DNA tem todas estas características.

    Diferentemente, um cristal não tem a capacidade de codificar informação para garantir a sua ulterior reprodução.

    O DNA contém a informação que permite à maquinaria de uma célula (como uma linha de montagem) construir, combinar e integrar todos os compostos físicos necessários ao fabrico de diferentes seres vivos, extremamente complexos.

    Na verdade, o código do DNA é totalmente se não existir um mecanismo extremamente complexo, capaz de reconhecer, transcrever, traduzir e executar cada uma das suas instruções e transformá-las, simultaneamente, em aminoácidos e proteínas.

    E o mais intrigante é que essa maquinaria não existe se não tiver sido codificada no DNA.

    O que veio primeiro? O DNA ou a maquinaria necessária à sua tradução, execução e cópia?

    A informação contida no DNA não é física. Ela não tem propriedades físicas. Como dizia Norbert Wiener, “informação não é matéria nem energia. Informação é informação”.

    A informação contida no DNA representa toda uma realidade para além do DNA.

    De resto, aumentam os exemplos em que a informação biológica está a ser traduzida e escrita em linguagem humana, ao mesmo tempo que o DNA está a ser utilizado para armazenar informação não biológica.

    O DNA, com as suas elevadas quantidades de informação, é inteiramente consistente com a crença num Deus que criou a vida pela sua Palavra.


    P.S. se os meus alunos, fazendo uso da sua inteligência e de um código, responderem aos pontos em coreano ou em swahilli arranjo um tradutor. Talvez não seja um tradutor tão eficaz como o sistema de tradução contido no DNA, mas algo se há-de arranjar.

    ResponderEliminar
  29. E para quem acredita em Vishnu?

    :|

    ResponderEliminar
  30. Não resisto.

    "O que veio primeiro? O DNA ou a maquinaria necessária à sua tradução, execução e cópia?"

    Esta não é a velha questão da galinha e do ovo?

    Sério! Claro que a pensar assim a única resposta é recorrer a um criador (nunca mas nunca o aborreçam, principalmente se tiverem filhos crianças)!

    ResponderEliminar
  31. (ou nao souberem nadar)

    ResponderEliminar
  32. "Pelo menos isso permitir-lhe à perceber melhor porque é que a esmagadora maioria das mutações genéticas é deletéria, afectando as funções celulares e a robustez (fitness) dos seres vivos e podendo conduzir às mais diversas doenças e nalguns casos à morte."

    Até eu já consigo responder a esta.
    Vá lá, todos juntos: A evolução actua sobre populações e não sobre individuos.
    Os mortos não evoluem...

    ResponderEliminar
  33. "Pelo menos isso permitir-lhe à perceber melhor porque é que a esmagadora maioria das mutações genéticas é deletéria, afectando as funções celulares e a robustez (fitness) dos seres vivos e podendo conduzir às mais diversas doenças e nalguns casos à morte."


    ISSO! A maioria mas não todas! Algumas... VOILÁ! Será que já entendeu?

    ResponderEliminar
  34. criacionista anónimo04/04/08, 21:03

    diferenças:

    0111MCSDXXZZY0001
    0001111BBBNNNVVVX
    AAAAA11110000XXXX
    PPRRTTT000111===!

    método de cálculo:

    equação de rochaminov ajustada pelo terceiro diferencial de pierre lanceloti e optimizada pelo algoritmo de Yauca.

    E agora Ludwig?

    ResponderEliminar
  35. Para o Ludwig, a informação compreende-se única exclusivamente pela sua dimensão matemática e estatística.

    Isto, apesar dessa dimensão estatística poder conduzir a considerar que a sequência “sogjwojhwjhoºwjkwe” tem mais conteúdo informativo do que a fórmula de Einstein E=mc^2 (resultado manifestamente absurdo.

    Além disso, não lhe fornece qualquer critério para distinguir entre uma sequência aleatória de letras e uma informação essencial à sobrevivência.

    É claro que o Ludwig, depois de dizer que a qualidade da informação não interessa, apressa-se a repudiar essa sua teoria da informação (que considera ser a única existente!), quando tem que avaliar a qualidade da informação dos seus alunos e ver qual é a informação que revela um conhecimento mais profundo das questões científicas.

    Afinal a qualidade da informação existe. Mesmo para o Ludwig!

    O Ludwig insiste em perguntar como é que se distingue entre uma sequência aleatória de letras e uma mensagem propriamente dita.

    Nós insistimos na nossa resposta:

    a distinção está na ausência ou na presença de informação codificada, passível de ser descodificada com sucesso para transmitir uma ideia ou para permitir a realização de uma ou várias operações.

    Para isso é necessária uma linguagem.

    A sequência das letras é irrelevante se não existir uma linguagem que permita dar sentido a essa sequência.

    Depois, é só preciso aprender essa linguagem.

    O DNA tem essas características.

    Na célula existe um mecanismo molecular altamente complexo (especificado através de DNA!) com uma capacidade pré-programada para reconhecer o significado das diferentes sequências de nucleótidos e adoptar as operações para a execução das instruções que elas contêm.

    O DNA sem estes mecanismos de transcrição, leitura, tradução e execução não tem qualquer significado ou utilidade.

    Por seu lado, estes mecanismos de descodificação e execução também não funcionam sem DNA.

    Tudo tinha que existir perfeito e completo desde o princípio, tal como a Bíblia ensina.

    O DNA tem informação.

    E tem-na numa quantidade e numa qualidade que transcende toda e qualquer informação humana.

    Assim é porque a inteligência e conhecimento de Deus são muito maiores do que a inteligência e o conhecimento humanos.

    A Bíblia afirma que para Deus não existe nada demasiadamente difícil.

    Ele tem toda a informação, não necessitando da experiência ou de tentativas e erros para ir adquirindo mais informação.

    Daí que a Criação tenha sido instantânea e tenha fechado o circuito informativo da vida.

    O Ludwig fala do coreano e do swahili, aparentemente sem se dar conta que se trata de linguagens criadas de forma inteligente para transmitir informação de origem inteligente.

    Essas linguagens são o produto de inteligência. A informação que elas transmitem também.

    O que é que isso tem que ver com a evolução aleatória? Nada!

    A presença de uma linguagem no DNA usada para armazenar e transmitir informação em quantidade e qualidade inabarcáveis pela mente humana é um sinal evidente da existência de um Criador.

    Não podemos ver Deus, mas podemos ver o resultado da sua acção criadora inteligente.

    Podemos ver informação em grande quantidade e qualidade, sem que exista qualquer processo naturalista para a sua criação e para a criação de um código para o seu armazenamento e transmissão.

    A selecção natural selecciona informação pré-existente, eliminando a informação que se apresenta como sendo de má qualidade (do ponto de vista da adaptação e da sobrebivência). Ela não cria informação genética nova.


    As mutações introduzem ruido na informação pré-existente, afectando o funcionamento de sistemas complexos e funcionais pré-existentes, podendo causar doenças e morte.

    Dentro das células existem inúmeras máquinas moleculares cujas partes têm que estar presentes e integradas no mesmo instante para poderem funcionar.

    Tudo isto é absolutamente consistente com o ensino Bíblico.

    ResponderEliminar
  36. Hartman diz:

    "O problema é que o Deus da Biblia parece que criou a Terra em 6 dias e depois meteu baixa por 6000 (alegados) anos!! Deus trabalhava na Administração Pública Portuguesa?"

    Deus não meteu baixa. Ele escolheu um Povo, prometeu um Salvador, encarnou em Jesus Cristo, chamou os seus seguidores e promete voltar outra vez, dar vida eterna a quem o aceitar como Salvador e restaurar toda a Criação que havia sido amaldiçoada e corrompida por causa do pecado humano.

    A sua mensagem ainda está connosco no século XXI, cuidadosamente preservada no Velho e no Novo Testamentos.

    ResponderEliminar
  37. Com Dá diz:

    "A epistemologia genética afirma que os indivíduos iniciam a sua aprendizagem após o nascimento (ou mesmo até ainda durante a vida intra-uterina). Como é que isso é possível? Como é que o indivíduo pode descodificar a informação se ainda não possui a semântica necessária?"

    A resposta será mais clara se se pensar que os seres vivos trazem em si programas pré-definidos criados por um Deus omnipotente e omnisciente. Isso nada tem que ver com uma suposta evolução.

    ResponderEliminar
  38. "A resposta será mais clara se se pensar que os seres vivos trazem em si programas pré-definidos criados por um Deus omnipotente e omnisciente."


    Bill Gates? Por isso é que o ser humano já vem todo cheio de defeitos e erros fatais de origem!! Obrigado pelo esclarecimento, caro Jónatas!

    ResponderEliminar
  39. tizO Rui Almeida insiste na endossimbiose, popularizada pela Professora Lynn Margulis nos anos setenta do século XX.

    O mais interessante é que o Rui Almeida pensa que os criacionistas nunca ouviram falar de uma teoria que tem quase quarenta anos!!

    Como é possível??

    A teoria da endossimbiose, assente na explicação de similaridades estruturas e genéticas (v.g.cloroplastos/mitocôndrias) ao nível molecular, parece plausível, mas apenas superficialmente.

    Na prática, estas organelas e a sua relação com as células é extremamente complexa.

    Por exemplo, nem todas as proteínas necessárias para o funcionamento das organelas se encontram nos seus próprios genomas.

    Em vez disso, alguns códigos dessas proteínas encontram-se no núcleo da célula.

    As proteínas das organelas que não fossem fabricadas dentro das próprias organelas teriam que ser transferidas para essas organelas.

    Isso envolve um mecanismo extremamente complexo de transferência de proteínas, compreendendo múltiplas passagens alternativas, cada uma delas envolvendo numerosas proteínas para o transporte das proteínas para as mitocôndrias e cloroplastos.

    Como é que uma passagem de transporte de organelas, constituída por multiplas partes, todas necessárias ao funcionamento dessa via de transporte poderia evoluir em pequenos passos incrementais?

    Não poderia, porque o alegado processo evolutivo iria descartando tudo o que não é imediatamente funcional.

    Daí que essa via de transporte tenha que ter sido criada por Deus instantâneamente e plenamente funcional.

    As alegadas similaridades estruturais e genéticas (em que se apoia a teoria da endossimbiose) não são o resultado de um ancestral comum, mas de um Criador comum!

    P.S. Os trabalhos mais recentes da professora evolucionista Lynn Margulis têm acabado, inadvertidamente, por corroborar ainda mais a doutrina da criação.

    Assim é, porque mostram que o registo fóssil das plantas está mais definido do que nunca, desse modo atestando mais claramente do que nunca que nenhum género de plantas é ancestral ou descendente de qualquer outro.

    As plantas reproduzem-se segundo a sua espécie, tal como diz a Bíblia.



    Algumas dificuldades com que se tem deparado a teoria da endosimbiose podem ver-se em:

    T. Martin Embley and William Martin, Eukaryotic evolution, changes and challenges, Nature, 440(30):623–630, 2006.

    Sobre as investigações de Lynn Margulis sobre a origem e a “evolução” das plantas pode ver-se:

    Margulis L. and Schwartz K.V., Five Kingdoms: An Illustrated Guide to the Phyla of Life on Earth, 3rd ed., Freeman, New York, 1998

    ResponderEliminar
  40. Caro Jónatas,

    «O Ludwig reconhece que a informação que os seus alunos lhe fornecem pode ser melhor ou pior, mais ou menos importante.»

    Não. Já lhe disse várias vezes que, no sentido técnico, é absurdo façar da qualidade da informação.

    E o que eu avalio é a qualidade da resposta, a semântica que dou à sequência de símbolos. Uma resposta 100% correcta dada em coreano vai, de acordo com a sua hipótese, ter "informação de qualidade" mas leva 0 à mesma porque eu não sei ler coreano e não vou perceber que está correcta.

    «Isto, apesar dessa dimensão estatística poder conduzir a considerar que a sequência “sogjwojhwjhoºwjkwe” tem mais conteúdo informativo do que a fórmula de Einstein E=mc^2 (resultado manifestamente absurdo.»

    Não é nada absurdo, porque a informação é aquilo que precisamos para espeficar a sequência de símbolos e não o seu significado. Isto já lhe foi explicado várias vezes, Jonatas. Eu posso usar o símbolo "x" para não dizer nada ou para dizer "não te esqueças de apagar o lume quando saires de casa senão a sopa fica queimada". A quantidade de informação não varia conforme a minha interpretação do símbolo.

    ResponderEliminar
  41. Criacionista anónimo,

    «equação de rochaminov ajustada pelo terceiro diferencial de pierre lanceloti e optimizada pelo algoritmo de Yauca.

    E agora Ludwig?»


    Agora? Nada. Penso que foi bastante mais eloquente do que eu poderia ter sido...

    ResponderEliminar
  42. Hartman diz:

    "Bill Gates?"

    É interessante que fale de Bill Gates, o mesmo que reconheceu que o DNA é o software mais sofisticado que se conhece, muito para além das capacidades de programação humanas.

    "Por isso é que o ser humano já vem todo cheio de defeitos e erros fatais de origem!!"

    A Bíblia diz que Deus criou o homem perfeito e livre.

    Deus não precisou de tentativas e erros ou de extinções massivas para criar o homem.

    Mas disse-lhe que se pecasse, a morte entraria no mundo.

    Na sua liberdade o ser humano escolheu pecar e a morte, como castigo pelo pecado, entrou no mundo. Daí o carácter pernicioso das mutações.

    Com o alastramento da violência incontida sobre a Terra, Deus castigou o mundo com um dilúvio global, poupando apenas 8 pessoas e todos os géneros animais, de forma a preservar o respectivo "pool genético".

    Assim se compreende a existência de fósseis em todos os continentes, abruptamente sepultados e petrificados, antes mesmo de se decomporem.

    Assim se compreende, igualmente, a dispersão, isolamento, especiação, adaptação e selecção natural pós-diluvianos.

    Mas Deus encarnou em Jesus Cristo, sem pecado, para morrer pelos nossos pecados.

    Assim se realizou a justiça de Deus (incompatível com a impunidade do mal) e o seu amor por nós (pois Deus não quer que ninguém se perca, mas que todos venham a aceitar a Salvação em Cristo).

    Ao terceiro dia, Jesus Cristo ressuscitou com um corpo incorruptível, prometendo a ressurreição e um corpo idêntico a todos os que o aceitarem como Salvador.

    No fim dos tempos, Deus promete restaurar toda a Criação com todos aqueles que aceitaram Jesus como Salvador e Senhor.

    Tudo isto, note-se, não com base no funcionamento das leis naturais, mas no poder do Deus que, ao criar o Universo, criou essas mesmas leis naturais.

    Jesus disse: "Eu sou a ressurreição e a vida. Quem crê em mim ainda que esteja morto viverá"

    É isso que está em causa. Tal como o primeiro casal, Adão e Eva, os leitores deste blogue são livres para aceitar Jesus como seu salvador ou para o rejeitar.

    ResponderEliminar
  43. Ludwig diz:

    "Uma resposta 100% correcta dada em coreano vai, de acordo com a sua hipótese, ter "informação de qualidade" mas leva 0 à mesma porque eu não sei ler coreano e não vou perceber que está correcta."

    Está bem. Se calhar eu faria o mesmo.

    Mas a verdade é que no seu exemplo existe um código, existe informação de qualidade, tudo com origem inteligente, mas não existe capacidade, por parte do receptor, de compreender a informação.

    Por outras palavras, neste caso dos coreanos, existe linguagem, codigo e informação executável, pelo menos por coreanos.

    Provavelmente é graças a isso que podemos ter os Hyundai, Kia, SamSung, Daewoo, etc.

    O mesmo sucede com o DNA. Graças ao seu funcionamento podemos obter as mais variadas espécies animais e vegetais, e o ser humano.

    Mas já não sucede com os cristais, que são estruturas sem informação codificada que assegure a sua reprodução.

    O seu exemplo dos coreanos não desmente o que temos dito acerca da informação. Pelo contrário, reforça-o, porque não prescinde de uma origem inteligente da informação.

    A verdade é que no DNA existe o código, existe a informação e existe o mecanismo extremamente complexo para transcrever, traduzir, executar e copiar a informação.

    (Nisso, o DNA funciona melhor do que o nosso (des)conhecimento da língua coreana.)

    E o mais notável, é que essa complexa maquinaria, necessária à descodificação do DNA, se encontra especificada no DNA.

    O DNA é inútil sem a maquinaria de descodificação, e esta não funciona sem DNA!

    Isso, é inteiramente consistente com a criação instantânea da vida.

    Muitas pessoas também não percebem o que significa E=mc^2.

    A teoria de Shannon também não distingue isso de um conjunto aleatório de símbolos.

    Essas pessoas e a teoria de Shannon estão ao mesmo nível.

    Como disse, Shannon pretendeu estudar apenas a transmissão e o armazenamento da informação e não tanto a informação em si mesma, enquanto conceito multidimensional.

    Não podemos pegar numa teoria que foi pensada para resolver problemas específicos de armazenamento e transmissão de informação e usá-la para tentar impor um limite unidimensional e estatístico ao conceito de informação.

    ResponderEliminar
  44. Ludwig diz:

    "Eu posso usar o símbolo "x" para não dizer nada ou para dizer "não te esqueças de apagar o lume quando saires de casa senão a sopa fica queimada". A quantidade de informação não varia conforme a minha interpretação do símbolo."

    É sem dúvida um exemplo muito interessante!

    Do ponto de vista do armazenamento e da transmissão de informação, x ocupa sempre o mesmo espaço.

    Até aqui Shannon tem razão.

    No entanto, na segunda alternativa apresentada, o Ludwig convenciona com outra pessoa atribuir a X um significado que só o Ludwig e a outra pessoa conhecem.

    Nesse caso, o Ludwig e a outra pessoa criaram um código (usando a a vontade e a inteligência de ambos) para transmitir uma mensagem ("não te esqueças de apagar o lume") para conseguir uma acção (o acto de apagar o lume) para atingir um determinado resultado (não queimar a sopa).

    Tanto a informação como o código têm origem inteligente.

    Neste caso, embora mantendo o valor estatístico e probabilístico de um simples x, este símbolo foi usado como um código (dimensão sintática) para transmitir uma mensagem (dimensão semântica) para obter uma acção (dimensão pragmática) para atingir um resultado (dimensão apobética).

    Como vê, no primeiro caso x não tem informação codificada.

    No segundo caso, x tem informação codificada, estando presentes todas as diferentes dimensões da informação.

    Aquilo que eu digo, é que se passa com os cristais é idêntico ao caso em que x não tem informação codificada. Os cristais não têm informação codificada.

    Diferentemente, o que se passa com o DNA é idêntico ao que sucede no caso em que x tem informação codificada.

    No DNA existe informação, existe um código, existe a descodificação da informação, a sua execução e a prossecução de diferentes operações tendo em vista a criação de diferentes espécies animais, vegetais e seres humanos, estabelecendo entre si relações simbióticas extremamente complexas.

    A teoria de Shannon passa ao lado do facto de que a um simples x pode ser adscrita uma quantidade enorme de informação, à semelhança do que sucede com a fórmula E=mc^2.

    ResponderEliminar
  45. Mário Miguel05/04/08, 00:57

    Caro Jonatas,

    «A Bíblia diz que Deus criou o homem perfeito e livre.»

    Mas se o Homem pecou, então não há a mínima hipótese de ele ser perfeito. Um ser perfeito não pode em caso algum pecar. A definição de perfeito não pode nem dá a mínima margem de manobra.
    Logo a Bíblia está errada, contradizendo-se de forma clara.

    E já que fala de Adão e Eva, a geração seguinte é necessariamente fruto de incesto, devido a Deus não ter sido perfeito; tendo colocado unicamente um casal no paraíso. Deus criou as condições (podia ter criado outras) para não houvesse a mínima hipótese de não ocorrer o que ele aponto como pecado. Isto não é compatível com Deus perfeito.

    ResponderEliminar
  46. Mário Miguel05/04/08, 01:34

    Onde está «geração seguinte» leia-se,
    2.ª geração. Filhos dos filhos de Adão e Eva.

    ResponderEliminar
  47. 000110100011100100110100
    010110110111111000111110



    Ora bem, as minhas estatísticas atribuem uma maior probabilidade inteligente à 2ª sequência do que à 1ª, embora para mim ambas sejam ininteligíveis!

    Hummm... este campo da informação é de facto interessantíssimo e cá por mim tenho gostado da exposição do Perspectiva. Aliás, isto está muito conforme a tudo quando tenho dito sobre a consciência preceder a matéria, uma ideia obviamente não materialista.

    Ainda assim, dum ponto de vista estritamente filosófico não se percebe a possibilidade de estruturas inteligentes ou com propósito serem criadas a partir de processos puramente aleatórios ou cegos. A evolução tem que pressupor um "plus", seja ele a consciência ou inteligência ou informação prévia e é este neste sentido que estas mensagens do Perspectiva me parecem lógicas e coerentes.

    Quanto aos tais exemplos dos 24 bits na sequência de 0 e 1, e como também foi referido a propósito da descodificação das mensagens em diferentes línguas, a questão da inteligência ou não só se põe justamente na possibilidade de uma ou outra sequência poderem ser interpretadas pelo receptor que as saiba ou consiga descodificar. Assim sendo, é a tal qualidade e não quantidade de informação de que também se fala.

    Por fim, parece ser cada vez mais difícil sustentar que o mero e misterioso "acaso" seja o único responsável por toda esta criação material. Não é apenas uma questão de ainda se estar longe de poder explicar todo o processo evolutivo, o que é compreensível, mas sim de ele continuar a não ser filosoficamente defensável, o que constitui um óbice bastante maior.

    Still the answer is already blowing somewhere... and we're getting there! :)


    PS: E para quem acredita em Vishnu?

    Eu acredito em Vishnu, ó Leandro... para além do arco-íris, um biqueiro do camandro!!! :D

    ResponderEliminar
  48. Leprechaun,

    «Ora bem, as minhas estatísticas atribuem uma maior probabilidade inteligente à 2ª sequência do que à 1ª, embora para mim ambas sejam ininteligíveis!»

    Na verdade é o contrário. A 2ª é que foi por moeda ao ar.

    A primeira é o código ascii de "Ola", em binário, trocando os bits par. Para descodificar:

    000110100011100100110100

    trocar os bits na posição par:

    010011110110110001100001

    converter em 3 números de 8 bits:

    79, 108, 97

    E consultar a tabela.

    ResponderEliminar
  49. Leprechaun,

    «uma ou outra sequência poderem ser interpretadas pelo receptor que as saiba ou consiga descodificar. Assim sendo, é a tal qualidade e não quantidade de informação de que também se fala.»

    Esta é a grande confusão. Se querem usar "informação" para designar isto, pois estão à vontade, mas isso não é o termo técnico. Se querem invocar a legitimidade da teoria da informação têm que pôr a semântica de lado porque essa análise é puramente sintática. É acerca das combinações de símbolos e não acerca daquilo que alguém convencionou que eles representam.

    E neste sentido técnico a afirmação que as mutações só diminuem a informação é demonstradamente falsa. No outro sentido a afirmação é falsa à mesma, mas sendo tão vaga e subjectiva é mais difícil demonstrá-lo.

    ResponderEliminar
  50. Jónatas,

    «Diferentemente, o que se passa com o DNA é idêntico ao que sucede no caso em que x tem informação codificada.»

    Nesse caso, e tendo em atenção que
    «o Ludwig convenciona com outra pessoa atribuir a X um significado que só o Ludwig e a outra pessoa conhecem.», peço-lhe que identifique quem é o destinatário do ADN da cebola, com quem o criador desse ADN terá combinado um código convencional para transmitir a mensagem inteligente codificada no ADN de cebola.

    É que se Ele está a tentar comunicar com a cebola temo que Ele esteja a perder o Seu tempo...

    ResponderEliminar
  51. Caro Jonatas, sobre a Arca de Noe, pelo que eu me lembro Deus supostamente convocou um especime feminino e um especime masculino de cada especie animal para comparecer na Arca à hora tal do dia tal com o intuito de sobreviverem e propagarem apos um diluvio. Ora, começando pela dificuldade logistica da coisa (os ursos polares, coitados, ainda tinham um grande esticao pela frente, bem como os alces do norte do Canada), como ainda tiveram que sobreviver apertados com mais uns largos milhoes de especies numa apertada arca durante 8 dias, em que a comida devia ser escassa (a nao ser, é claro, que se fossem predando uns aos outros, mas ai derrotava-se em parte o espirito da Arca), para finalmente chegarem ao seu destino passados 8 dias.
    Sem esquecer do Sr. Corvo, que foi à procura de um ramo de oliveira e nao voltou, deixando a senhora Corvo sozinha. Sera que a pobre coitada teve que pedir ao camarada sr. Melro para a ajudar na propagaçao da especie?

    Mas nao se preocupem, caros amigos creacionistas. Eu continuo a acreditar na historia da Arca. Alias, consigo encontrar um excelente paralelismo hoje em dia: as linhas férreas na India.

    Rui Almeida.

    ResponderEliminar

Se quiser filtrar algum ou alguns comentadores consulte este post.